Your Ridiculously Long Name

Forum Games!
Forum rules
Please read the forum rules carefully before you post.

If you like AnimorphsFanForum.com, please consider making a donation. Any donation will go towards the cost of the hosting, the domain and any other running costs.
User avatar
diogopess
Warrior
Warrior
Posts: 117
Joined: Sun Sep 13, 2009 3:54 am
Gender: [Male][/Male]
Favourite Animorph: Tobias
Location: Portugal

Re: Your Ridiculously Long Name

Post by diogopess » Tue Sep 22, 2009 10:29 am

My name is Preteelpseposepo
DelvigolorbogolaorboPreteelpseposepo

Bond, James Bond Is a better catch frase
Diogo Pess

User avatar
bindaaskshitij
Donator
Donator
Posts: 2430
Joined: Sat Dec 01, 2007 8:44 am
Gender: [Male][/Male]
Favourite Animorph: Marco
Location: Utopia!...........I wish!

Re: Your Ridiculously Long Name

Post by bindaaskshitij » Tue Sep 22, 2009 8:59 pm

Sorry...but that's already taken by capn....he gets all the good ones...coz if someone else gets it he bans them...Till date he has banned 7.36 members of this community :P:P
Quantum materiae materietur marmota monax si marmota monax materiam possit materiari?

Image

User avatar
Kieranali
Warrior
Warrior
Posts: 107
Joined: Mon Aug 31, 2009 5:30 am
Gender: [Female][/Female]
Favourite Animorph: Cassie

Re: Your Ridiculously Long Name

Post by Kieranali » Wed Sep 23, 2009 3:20 am

Kruigol Eelprehtawg Niwdawg Luhfigol
...... Honestly, I'm confused right now..

User avatar
diogopess
Warrior
Warrior
Posts: 117
Joined: Sun Sep 13, 2009 3:54 am
Gender: [Male][/Male]
Favourite Animorph: Tobias
Location: Portugal

Re: Your Ridiculously Long Name

Post by diogopess » Wed Sep 23, 2009 10:25 am

LoL he's named James Bond?? Really?
Diogo Pess

User avatar
Blu
Rampant Drunk
Rampant Drunk
Posts: 4650
Joined: Wed Jul 09, 2008 8:07 am
Gender: [Male][/Male]
Location: Behind you

Re: Your Ridiculously Long Name

Post by Blu » Mon Sep 28, 2009 2:52 am

My name is Adolph Blaine Charles David Earl Frederick Gerald Hubert Irvim John Kenneth Loyd Martin Nero Oliver Paul Quincy Randolph Sherman Thomas Uncas Victor Willian Xerxes Yancy Zeus and i live in Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajan-
iwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

User avatar
diogopess
Warrior
Warrior
Posts: 117
Joined: Sun Sep 13, 2009 3:54 am
Gender: [Male][/Male]
Favourite Animorph: Tobias
Location: Portugal

Re: Your Ridiculously Long Name

Post by diogopess » Sun Oct 11, 2009 1:17 pm

loooool! XD
Diogo Pess

User avatar
Visser 5
Admiral
Admiral
Posts: 1196
Joined: Thu Dec 10, 2009 3:59 pm
Gender: [Female][/Female]
Favourite Animorph: Tobias
Location: United States of America

Re: Your Ridiculously Long Name

Post by Visser 5 » Wed Dec 16, 2009 4:15 pm

That makes me, valdigolseposepoeelprehtphal, the Queen of the Universe!!!
Vote for me! I will fix everything, giving everyone health care, food, a home with high speed internet and a good paying job, & kill everyone who makes more then $1 million per year &give their money to the poorest 10%.

User avatar
Blueberry Chicken
Admiral
Admiral
Posts: 603
Joined: Wed Oct 14, 2009 5:09 pm
Gender: [Female][/Female]
Favourite Animorph: Marco
Location: A place in the universe. Or maybe not...

Re: Your Ridiculously Long Name

Post by Blueberry Chicken » Sun Dec 20, 2009 4:38 pm

My name would be:
Blarluhfungoeelpblareelprehtrehtyelk Criohuwfigolcriokrueelpniwd

Blueberry Chicken results in a looong name.
"Sass, back before you, me, Blu, Vulf and BB used to roll together.We were tighter than emo jeans."
-Dest

User avatar
bindaaskshitij
Donator
Donator
Posts: 2430
Joined: Sat Dec 01, 2007 8:44 am
Gender: [Male][/Male]
Favourite Animorph: Marco
Location: Utopia!...........I wish!

Re: Your Ridiculously Long Name

Post by bindaaskshitij » Sun Dec 20, 2009 10:15 pm

You can call Blu Rampant Drunk though...thats his real name..
Quantum materiae materietur marmota monax si marmota monax materiam possit materiari?

Image

User avatar
Tobias_Marco
Proud Uncle
Proud Uncle
Posts: 6069
Joined: Fri Nov 06, 2009 12:42 pm
Gender: [Male][/Male]
Favourite Animorph: Tobias
Location: Somewhere in the realm of time/space

Re: Your Ridiculously Long Name

Post by Tobias_Marco » Thu Jul 25, 2013 9:14 pm

<Hi, my name is Toxorboblarigolawgsepo_Mawawgrehtcrioorbo, and I just flew in from Washington state, USA, and boy are my arms tired!>
True education, true science, true religion is the search for truth.
Matthew 28:16-20, John 3:14-20